PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02894.1.g00080.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 390aa    MW: 41769.1 Da    PI: 11.1344
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02894.1.g00080.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.54.6e-18218272256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   rk+ +++keq   Lee F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  Zpz_sc02894.1.g00080.1.am.mk 218 RKKLRLSKEQSAFLEESFKEHSTLNPKQKAALARQLNLRPRQVEVWFQNRRARTK 272
                                   788899***********************************************98 PP

2HD-ZIP_I/II127.75e-41218307191
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk+rlskeq+++LEesF+e+++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL+
  Zpz_sc02894.1.g00080.1.am.mk 218 RKKLRLSKEQSAFLEESFKEHSTLNPKQKAALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTAENRRLH 298
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLreel 91 
                                   ke +eLr +l
  Zpz_sc02894.1.g00080.1.am.mk 299 KELAELR-AL 307
                                   ******9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-18201268IPR009057Homeodomain-like
SuperFamilySSF466892.82E-18206275IPR009057Homeodomain-like
PROSITE profilePS5007117.248214274IPR001356Homeobox domain
SMARTSM003898.4E-16216278IPR001356Homeobox domain
PfamPF000461.6E-15218272IPR001356Homeobox domain
CDDcd000863.55E-16218275No hitNo description
PROSITE patternPS000270249272IPR017970Homeobox, conserved site
SMARTSM003403.8E-20274318IPR003106Leucine zipper, homeobox-associated
PfamPF021839.7E-11274308IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MELGLSLGKA AVAEAGTAAP ELGLGLGVGA GAARRVEGGN ATAAAAVGGR WWAAAPAASP  60
EPAVRLSLVS SLGLQWPPSG TGECRAINRV VVDFPYLSLR FGLASACTSN GTVTDPGAGV  120
VPPLHAGSSD APRRGFDVNR APSVTVSAAA GAAGLVDEDD DDGEGDRAAA LSSSPNDSGG  180
SFPLDLGRRV HAEGAAQACG GERSSSRASD EDEGASARKK LRLSKEQSAF LEESFKEHST  240
LNPKQKAALA RQLNLRPRQV EVWFQNRRAR TKLKQTEVDC EYLKRCCETL TAENRRLHKE  300
LAELRALKXX XXPPVFRHRR ASTGRRRSPR CSRPPAASRW PPSRGRRRRR ATVCKYSLRQ  360
CASREKFWGF RGRTLPSRSR LGSGKWRLLG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1266274RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2411961e-149AK241196.1 Oryza sativa Japonica Group cDNA, clone: J065121H01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012702116.11e-108PREDICTED: homeobox-leucine zipper protein HOX27-like
SwissprotA2YW033e-99HOX27_ORYSI; Homeobox-leucine zipper protein HOX27
SwissprotQ6YPD03e-99HOX27_ORYSJ; Homeobox-leucine zipper protein HOX27
TrEMBLK3YL331e-108K3YL33_SETIT; Uncharacterized protein
STRINGSi014954m1e-108(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.19e-51homeobox from Arabidopsis thaliana